VPS26C Rabbit Polyclonal Antibody
CAT#: TA330298
Rabbit Polyclonal Anti-DSCR3 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for Anti-DSCR3 antibody is: synthetic peptide directed towards the middle region of Human DSCR3. Synthetic peptide located within the following region: SAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQP | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 27 kDa | 
| Gene Name | DSCR3 arrestin fold containing | 
| Database Link | |
| Background | The function of this protein remains unknown. | 
| Synonyms | DCRA; DSCRA | 
| Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86% | 
| Reference Data | |
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 

 
                        
 
        