CDC42 Rabbit Polyclonal Antibody

CAT#: TA330323

Rabbit Polyclonal Anti-CDC42 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3
    • 100 ug

CNY 3080.00


Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 21 kDa
Gene Name cell division cycle 42
Background CDC42 is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants.
Synonyms CDC42Hs; G25K
Note Immunogen sequence homology: Wuchereria bancrofti:100%; Leucosolenia sp. AR-2003:100%; cloud sponge:100%; Choanoflagellate:100%; Pea aphid:100%; Yellowfever mosquito:100%; Caenorhabditis elegans:100%; Chicken:100%; Pacific transparent sea squirt:100%; Tun
Reference Data
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, Chemokine signaling pathway, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Fc gamma R-mediated phagocytosis, Focal adhesion, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, Pancreatic cancer, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Tight junction, VEGF signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...