CMKLR1 Rabbit Polyclonal Antibody
CAT#: TA330389
Rabbit Polyclonal Anti-CMKLR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 42 kDa |
| Gene Name | chemerin chemokine-like receptor 1 |
| Database Link | |
| Background | CMKLR1 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB. |
| Synonyms | CHEMERINR; ChemR23; DEZ; RVER1 |
| Note | Immunogen sequence homology: Human: 100%; Mouse: 93%; Rat: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
