RGS3 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 57 kDa |
| Database Link | |
| Background | RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. |
| Synonyms | C2PA; PDZ-RGS3; RGP3 |
| Note | Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Chicken: 76% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Axon guidance |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
