SFRP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	secreted frizzled related protein 1
Database Link	NP_003003 Entrez Gene 6422 Human UniProt ID Q8N474
Background	This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009]
Synonyms	FRP; FRP-1; FRP1; FrzA; SARP2
Note	Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 93%; Chicken: 93%
Reference Data
Protein Families	Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
Protein Pathways	Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.