CHM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	CHM, Rab escort protein 1
Database Link	NP_000381 Entrez Gene 1121 Human UniProt ID P24386
Background	CHM binds unprenylated Rab proteins, presents it to the catalytic Rab GGTase dimer, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane.The choroideremia gene encodes for a protein, the Rab escort protein-1 (REP1), which is involved in membrane trafficking. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	DXS540; GGTA; HSD-32; REP-1; TCD
Note	Immunogen sequence homology: Human: 100%; Horse: 80%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.