DTX2 Rabbit Polyclonal Antibody

CAT#: TA330457

Rabbit Polyclonal Anti-DTX2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DTX2 antibody: synthetic peptide directed towards the C terminal of human DTX2. Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name deltex 2, E3 ubiquitin ligase
Background DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
Synonyms RNF58
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Notch signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...