RNF38 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNF38 antibody: synthetic peptide directed towards the N terminal of human RNF38. Synthetic peptide located within the following region: FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	ring finger protein 38
Database Link	NP_073618 Entrez Gene 152006 Human UniProt ID Q9H0F5
Background	RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms	FLJ21343
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.