DCST1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DCST1 antibody: synthetic peptide directed towards the C terminal of human DCST1. Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	DC-STAMP domain containing 1
Database Link	NP_689707 Entrez Gene 149095 Human UniProt ID Q5T197
Background	The function remains unknown.
Synonyms	FLJ32785; RP11-307C12.10
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 85%; Dog: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.