WDSUB1 Rabbit Polyclonal Antibody
CAT#: TA330512
Rabbit Polyclonal Anti-WDSUB1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-WDSUB1 antibody: synthetic peptide directed towards the middle region of human WDSUB1. Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | WD repeat, sterile alpha motif and U-box domain containing 1 |
Database Link | |
Background | WDSUB1 contains 1 SAM (sterile alpha motif) domain, 1 U-box domain and 7 WD repeats. The function of WDSUB1 remains unknown. |
Synonyms | UBOX6; WDSAM1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Goat: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |