PSMD14 Rabbit Polyclonal Antibody
CAT#: TA330547
Rabbit Polyclonal Anti-PSMD14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4381.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 35 kDa |
| Gene Name | proteasome 26S subunit, non-ATPase 14 |
| Database Link | |
| Background | POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]). |
| Synonyms | PAD1; POH1; RPN11 |
| Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Proteasome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
