NPAS4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NPAS4 antibody: synthetic peptide directed towards the middle region of human NPAS4. Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	neuronal PAS domain protein 4
Database Link	NP_849195 Entrez Gene 266743 Human UniProt ID Q8IUM7
Background	NXF is a member of the basic helix-loop-helix-PER (MIM 602260)-ARNT (MIM 126110)-SIM (see SIM2; MIM 600892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events.NXF is a member of the basic helix-loop-helix-PER (MIM 602260)-ARNT (MIM 126110)-SIM (see SIM2; MIM 600892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events (Ooe et al., 2004 [PubMed 14701734]). [supplied by OMIM]
Synonyms	bHLHe79; Le-PAS; NXF; PASD10
Note	Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 93%; Horse: 86%; Sheep: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.