CRTR1 (TFCP2L1) Rabbit Polyclonal Antibody
CAT#: TA330623
Rabbit Polyclonal Anti-TFCP2L1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TFCP2L1 antibody: synthetic peptide directed towards the middle region of human TFCP2L1. Synthetic peptide located within the following region: HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTD |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 55 kDa |
| Gene Name | transcription factor CP2-like 1 |
| Database Link | |
| Background | TFCP2L1 is a transcriptional suppressor. TFCP2L1 may suppress UBP1-mediated transcriptional activation. It modulates the placental expression of CYP11A1. |
| Synonyms | CRTR1; LBP-9; LBP9 |
| Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
