HOXD1 Rabbit Polyclonal Antibody

CAT#: TA330643

Rabbit Polyclonal Anti-HOXD1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of homeobox D1 (HOXD1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the C terminal of human HOXD1. Synthetic peptide located within the following region: LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 34 kDa
Gene Name homeobox D1
Background HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms Hox-4.7; HOX4; HOX4G
Note Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 90%; Bovine: 90%; Zebrafish: 90%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...