MOSC2 (MARC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MARC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MARC2. Synthetic peptide located within the following region: ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	mitochondrial amidoxime reducing component 2
Database Link	NP_060368 Entrez Gene 54996 Human UniProt ID Q969Z3
Background	As a component of the benzamidoxime prodrug-converting complex, MARC2 is required to reduce N-hydroxylated prodrugs, such as benzamidoxime. It also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine.
Synonyms	MOSC2
Note	Human: 100%; Bovine: 91%; Dog: 82%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.