ZCWPW1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZCWPW1 antibody is: synthetic peptide directed towards the N-terminal region of Human ZCWPW1. Synthetic peptide located within the following region: FAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASLKKKEEKAT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	zinc finger CW-type and PWWP domain containing 1
Database Link	NP_060454 Entrez Gene 55063 Human UniProt ID Q9H0M4
Background	The function of this protein remains unknown.
Synonyms	ZCW1
Note	Human: 100%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.