SPATA5L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SPATA5L1 antibody is: synthetic peptide directed towards the C-terminal region of Human SPATA5L1. Synthetic peptide located within the following region: CDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	spermatogenesis associated 5 like 1
Database Link	NP_076968 Entrez Gene 79029 Human UniProt ID Q9BVQ7
Background	The function of this protein remains unknown.
Synonyms	FLJ12286; MGC5347
Note	Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Rat: 85%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.