C15orf29 (KATNBL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KATNBL1 antibody is: synthetic peptide directed towards the N-terminal region of Human KATNBL1. Synthetic peptide located within the following region: RTVGQTVKSPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKEN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	katanin regulatory subunit B1 like 1
Database Link	NP_078989 Entrez Gene 79768 Human UniProt ID Q9H079
Background	The function of this protein remains unknown.
Synonyms	C15orf29
Note	Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.