TMPRSS11E Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMPRSS11E antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transmembrane protease, serine 11E
Database Link	NP_054777 Entrez Gene 28983 Human UniProt ID Q9UL52
Background	TMPRSS11E is a Serine protease which possesses both gelatinolytic and caseinolytic activities. It shows a preference for Arg in the P1 position.
Synonyms	DESC1; TMPRSS11E2
Note	Human: 100%; Pig: 93%; Horse: 93%; Dog: 92%; Rat: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.