USP43 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-USP43 antibody is: synthetic peptide directed towards the C-terminal region of Human USP43. Synthetic peptide located within the following region: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	ubiquitin specific peptidase 43
Database Link	NP_694942 Entrez Gene 124739 Human UniProt ID Q70EL4
Background	USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. It is involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
Synonyms	FLJ30626
Note	Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.