ZDHHC22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZDHHC22 antibody is: synthetic peptide directed towards the C-terminal region of Human ZDHHC22. Synthetic peptide located within the following region: QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	zinc finger DHHC-type containing 22
Database Link	NP_777636 Entrez Gene 283576 Human UniProt ID Q8N966
Background	The function of this protein remains unknown.
Synonyms	C14orf59
Note	Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.