SOHLH2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SOHLH2 antibody is: synthetic peptide directed towards the N-terminal region of Human SOHLH2. Synthetic peptide located within the following region: MSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKAKIDILLVGD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	spermatogenesis and oogenesis specific basic helix-loop-helix 2
Database Link	NP_060296 Entrez Gene 54937 Human UniProt ID Q9NX45
Background	SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis.
Synonyms	bHLHe81; SOSF2; SPATA28; TEB1
Note	Human: 100%; Dog: 92%; Pig: 83%; Rat: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.