CCDC85C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	coiled-coil domain containing 85C
Database Link	NP_001138467 Entrez Gene 317762 Human UniProt ID A6NKD9
Background	CCDC85C may play an important role in cortical development, especially in the maintenance of radial glia.
Synonyms	FLJ22558; MGC117455
Note	Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 86%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.