ZBTB8B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZBTB8B antibody is: synthetic peptide directed towards the C-terminal region of Human ZBTB8B. Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	zinc finger and BTB domain containing 8B
Database Link	NP_001139192 Entrez Gene 728116 Human UniProt ID Q8NAP8
Background	ZBTB8B may be involved in transcriptional regulation.
Synonyms	ZNF916B
Note	Human: 100%; Dog: 93%; Rat: 86%; Horse: 86%; Rabbit: 86%; Pig: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.