TIP30 (HTATIP2) Rabbit Polyclonal Antibody
CAT#: TA331157
Rabbit Polyclonal Anti-HTATIP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | HIV-1 Tat interactive protein 2 |
Database Link | |
Background | CC3 (HTATIP2) is a member of the short-chain dehydrogenases/reductases (SDR) family. It is a novel serine/threonine kinase that phosphorylates the C-terminal domain (CTD) of the largest RNA polymerase II subunit and induces the expression of apoptosis related genes Bad and Siva, as well as metastasis suppressor NM23-H2. It also interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription. |
Synonyms | CC3; SDR44U1; TIP30 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |