TIP30 (HTATIP2) Rabbit Polyclonal Antibody
CAT#: TA331157
Rabbit Polyclonal Anti-HTATIP2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 27 kDa |
| Gene Name | HIV-1 Tat interactive protein 2 |
| Database Link | |
| Background | CC3 (HTATIP2) is a member of the short-chain dehydrogenases/reductases (SDR) family. It is a novel serine/threonine kinase that phosphorylates the C-terminal domain (CTD) of the largest RNA polymerase II subunit and induces the expression of apoptosis related genes Bad and Siva, as well as metastasis suppressor NM23-H2. It also interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription. |
| Synonyms | CC3; SDR44U1; TIP30 |
| Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
