JAB1 (COPS5) Rabbit Polyclonal Antibody

CAT#: TA331188

Rabbit Polyclonal Anti-COPS5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), 20 µg
    • 20 ug

CNY 2900.00


Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) (COPS5), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name COP9 signalosome subunit 5
Background The protein encoded by COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.
Synonyms CSN5; JAB1; MOV-34; SGN5
Reference Data
Protein Families Druggable Genome, Protease, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...