RIN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human RIN2. Synthetic peptide located within the following region: RTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCARDSGYDSLSNRLSI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	Ras and Rab interactor 2
Database Link	NP_061866 Entrez Gene 54453 Human UniProt ID Q8WYP3
Background	The function of this protein remains unknown.
Synonyms	MACS; RASSF4
Note	Human: 100%; Rat: 83%; Mouse: 83%; Dog: 80%; Pig: 80%; Horse: 80%; Bovine: 80%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.