STK33 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the C-terminal region of Human STK33. Synthetic peptide located within the following region: NVLEMMKEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	serine/threonine kinase 33
Database Link	NP_112168 Entrez Gene 65975 Human UniProt ID Q9BYT3
Background	The function of this protein remains unknown.
Synonyms	OTTHUMP00000178934; OTTHUMP00000178935; serine; threonine kinase 33
Note	Human: 100%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.