SYNRG Rabbit Polyclonal Antibody
CAT#: TA331234
Rabbit Polyclonal Anti-SYNRG Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SYNRG antibody is: synthetic peptide directed towards the N-terminal region of Human SYNRG. Synthetic peptide located within the following region: QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 119 kDa |
Gene Name | synergin, gamma |
Database Link | |
Background | This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. |
Synonyms | AP1GBP1; SYNG |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |