Tropomodulin 4 (TMOD4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMOD4 antibody is: synthetic peptide directed towards the middle region of Human TMOD4. Synthetic peptide located within the following region: CNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	tropomodulin 4
Database Link	NP_037485 Entrez Gene 29765 Human UniProt ID Q9NZQ9
Background	TMOD4 blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.
Synonyms	SK-TMOD
Note	Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.