Keratin 77 (KRT77) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT77 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT77. Synthetic peptide located within the following region: VRTQYELIAQRSKDEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	keratin 77
Database Link	NP_778253 Entrez Gene 374454 Human UniProt ID Q7Z794
Background	Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13.
Synonyms	K1B; KRT1B
Note	Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.