SLC13A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC13A4 antibody is: synthetic peptide directed towards the middle region of Human SLC13A4. Synthetic peptide located within the following region: NPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	solute carrier family 13 member 4
Database Link	NP_036582 Entrez Gene 26266 Human UniProt ID Q9UKG4
Background	SLC13A4 is a sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
Synonyms	NAS2; SUT-1; SUT1
Note	Human: 100%; Dog: 91%; Bovine: 90%; Horse: 85%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.