SEC31B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SEC31B antibody is: synthetic peptide directed towards the middle region of Human SEC31B. Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	128 kDa
Gene Name	SEC31 homolog B, COPII coat complex component
Database Link	NP_056305 Entrez Gene 25956 Human UniProt ID Q9NQW1
Background	This gene encodes a protein of unknown function. The protein has moderate similarity to rat VAP1 protein which is an endosomal membrane-associated protein, containing a putative Ca2+/calmodulin-dependent kinase II phosphorylation site.
Synonyms	SEC31B-1; SEC31L2
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.