TESK2 Rabbit Polyclonal Antibody
CAT#: TA331365
Rabbit Polyclonal Anti-TESK2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TESK2 antibody is: synthetic peptide directed towards the C-terminal region of Human TESK2. Synthetic peptide located within the following region: AHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFST |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | testis-specific kinase 2 |
Database Link | |
Background | This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis. |
Synonyms | MGC29168; OTTMUSP00000010191; testis-specific kinase 2 |
Note | Human: 100%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Pig: 83%; Dog: 79%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |