CHID1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CHID1 antibody is: synthetic peptide directed towards the N-terminal region of Human CHID1. Synthetic peptide located within the following region: CSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	chitinase domain containing 1
Database Link	NP_001136149 Entrez Gene 66005 Human UniProt ID Q9BWS9
Background	CHID1 is a saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro).
Synonyms	GL008; SI-CLP; SICLP
Note	Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.