KIAA0825 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C5orf36 antibody: synthetic peptide directed towards the N terminal of human C5orf36. Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	KIAA0825
Database Link	NP_775936 Entrez Gene 285600 Human UniProt ID Q8IV33
Background	The specific function of C5orf36 is not yet known.
Synonyms	C5orf36
Note	Pig: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Dog: 93%; Guinea pig: 93%; Bovine: 86%; Rat: 79%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.