Foxi2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxi2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AQAGGELDMAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	forkhead box I2
Database Link	NP_899016 Entrez Gene 270004 Mouse UniProt ID Q3I5G5
Background	The function of this protein remains unknown.
Synonyms	FLJ46831
Note	Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.