Rhox11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11. Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	reproductive homeobox 11
Database Link	NP_941000 Entrez Gene 194738 Mouse
Background	Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner; several are hormonally regulated, and their expression pattern during postnatal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
Synonyms	BC049711; Gm39; MGC58663
Note	Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.