Fam172a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Fam172a antibody: synthetic peptide directed towards the n terminal of mouse 1110033M05Rik. Synthetic peptide located within the following region: NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	family with sequence similarity 172, member A
Database Link	NP_001156891 Entrez Gene 68675 Mouse UniProt ID Q3TNH5
Background	The amino acid sequence of 1110033M05Rik is derived from an annotated genomic sequence (NT_039589) using gene prediction method: GNOMON, supported by mRNA and EST evidence.
Synonyms	C5orf21; DKFZP564D172
Note	Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.