PRSS55 Rabbit Polyclonal Antibody
CAT#: TA331524
Rabbit Polyclonal Anti-PRSS55 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 38 kDa |
| Gene Name | protease, serine 55 |
| Database Link | |
| Background | This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alternate splicing results in multiple transcript variants. |
| Synonyms | CT153; T-SP1; TSP1; UNQ9391 |
| Note | Immunogen sequence homology: Human: 100%; Pig: 90%; Mouse: 85%; Dog: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%; Rat: 77% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
