RNF148 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RNF148 Antibody: synthetic peptide directed towards the C terminal of human RNF148. Synthetic peptide located within the following region: PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	ring finger protein 148
Database Link	NP_932351 Entrez Gene 378925 Human UniProt ID Q8N7C7
Background	RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger. The exact function of RNF148 remains unknown.
Synonyms	MGC35222
Note	Immunogen sequence homology: Human: 100%; Rat: 85%; Yeast: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.