C1QL2 Rabbit Polyclonal Antibody
CAT#: TA331546
Rabbit Polyclonal Anti-C1QL2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C1QL2 Antibody is: synthetic peptide directed towards the middle region of Human C1QL2. Synthetic peptide located within the following region: GTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | complement component 1, q subcomponent-like 2 |
Database Link | |
Background | C1QL2 may regulate the number of excitatory synapses that are formed on hippocampus neurons. It has no effect on inhibitory synapses. |
Synonyms | C1QTNF10; CTRP10 |
Note | Immunogen sequence homology: Human: 100%; Rat: 92%; Dog: 86%; Pig: 85%; Mouse: 85%; Bovine: 85% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |