ZNF598 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF598 Antibody: synthetic peptide directed towards the middle region of human ZNF598. Synthetic peptide located within the following region: EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPGALPPPSPKLKDEDFPS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	zinc finger protein 598
Database Link	NP_835461 Entrez Gene 90850 Human UniProt ID Q86UK7
Background	ZNF598 contains 1 C2H2-type zinc finger and 1 RING-type zinc finger. The exact function of ZNF598 remains unknown.
Synonyms	DKFZp762F135; FLJ00086
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Mouse: 85%; Horse: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.