NSUN5 Rabbit Antibody
CAT#: TA331632
Rabbit Polyclonal Anti-NSUN5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Reactivity | Human |
| Host | Rabbit |
| Immunogen | The immunogen for Anti-NSUN5 Antibody is: synthetic peptide directed towards the C-terminal region of Human NSUN5. Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA |
| Isotype | IgG |
| Formulation | Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 50 kDa |
| Database Link | |
| Background | This gene encodes a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Synonyms | NOL1; NOL1R; NSUN5A; p120; p120(NOL1); WBSCR20; WBSCR20A |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
