FBXO17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FBXO17 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO17. Synthetic peptide located within the following region: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	F-box protein 17
Database Link	NP_680474 Entrez Gene 115290 Human UniProt ID Q96EF6
Background	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it contains an F-box domain. Alternative splicing of this gene results in 2 transcript variants encoding different isoforms
Synonyms	FBG4; Fbx17; FBX26; FBXO26
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.