NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse, Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NKX2-3 Antibody: synthetic peptide directed towards the N terminal of human NKX2-3. Synthetic peptide located within the following region: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | NK2 homeobox 3 |
Database Link | |
Background | NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. |
Synonyms | CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |