PPM1L Rabbit Polyclonal Antibody
CAT#: TA331661
Rabbit Polyclonal Anti-PPM1L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PPM1L Antibody is: synthetic peptide directed towards the middle region of Human PPM1L. Synthetic peptide located within the following region: SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | protein phosphatase, Mg2+/Mn2+ dependent 1L |
Database Link | |
Background | PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase signaling cascades that respond to extracellular stimuli. |
Synonyms | PP2C-epsilon; PP2CE; PPM1-LIKE |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Phosphatase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |