Psmg2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Psmg2 Antibody is: synthetic peptide directed towards the middle region of Mouse Psmg2. Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	proteasome (prosome, macropain) assembly chaperone 2
Database Link	NP_598899 Entrez Gene 107047 Mouse UniProt ID Q9EST4
Background	Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Synonyms	CLAST3; HCCA3; HDCMC29P; HSPC260; HsT1707; MDS003; MGC15092; PAC-2; PAC2; TNFSF5IP1
Note	Immunogen sequence homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Sheep: 92%; Guinea pig: 92%; Goat: 86%; Dog: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.