PDZD7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PDZD7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PDZD7. Synthetic peptide located within the following region: LSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	PDZ domain containing 7
Database Link	NP_079171 Entrez Gene 79955 Human UniProt ID Q9H5P4
Background	This gene encodes a ciliary protein homologous to proteins which are mutated in Usher syndrome patients, and mutations and translocations involving this gene have been associated with two types of Usher syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms	PDZK7
Note	Immunogen sequence homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.