PDZD3 Rabbit Polyclonal Antibody
CAT#: TA331732
Rabbit Polyclonal Anti-PDZD3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PDZD3 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDZD3. Synthetic peptide located within the following region: PDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 42 kDa |
| Gene Name | PDZ domain containing 3 |
| Database Link | |
| Background | Guanylyl cyclase C (GCC, or GUCY2C; MIM 601330) produces cGMP following the binding of either endogenous ligands or heat-stable enterotoxins secreted by E. coli and other enteric bacteria. Activation of GCC initiates a signaling cascade that leads to phosphorylation of the cystic fibrosis transmembrane conductance regulator (CFTR; MIM 602421), followed by a net efflux of ions and water into the intestinal lumen. IKEPP is a regulatory protein that associates with GCC and regulates the amount of cGMP produced following receptor stimulation. |
| Synonyms | IKEPP; NHERF4; PDZK2 |
| Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 86%; Horse: 79%; Bovine: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
